PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 27613.m000639
Common NameLOC8277579, RCOM_0047180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 562aa    MW: 60782.9 Da    PI: 7.3206
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
27613.m000639genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.16.6e-32212269260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  27613.m000639 212 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 269
                    8****************************************.***************85 PP

2WRKY106.31.6e-33377435159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  27613.m000639 377 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 435
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.9E-27209270IPR003657WRKY domain
SuperFamilySSF1182909.29E-25210270IPR003657WRKY domain
SMARTSM007744.1E-34211269IPR003657WRKY domain
PROSITE profilePS5081122.791212270IPR003657WRKY domain
PfamPF031061.6E-24212268IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-37362437IPR003657WRKY domain
SuperFamilySSF1182902.35E-29369437IPR003657WRKY domain
PROSITE profilePS5081138.825372437IPR003657WRKY domain
SMARTSM007743.1E-39377436IPR003657WRKY domain
PfamPF031063.3E-26378435IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MDTNSNNSGD PSRLDSDSGS AASVGGARYK LMSPAKLPIS RSPCITIPPG LSPTSFLESP  60
VLLSNVKAEP SPTTGSFAKP PTGHGSLGSN PYSATAVPSN AFGERTSSCF EFRPHPRSNL  120
VPADVHHRIT EQSVQVQGHC QNQSLASSPR VKSEMAVSSN EFSLSAPLPS SGTSAPGEVE  180
SDELNQIGVS NNGLQASQTD HKGGSGISMP SDDGYNWRKY GQKHVKGSEF PRSYYKCTHP  240
NCEVKKLFER SHDGQITEII YKGTHDHPKP QPSRRYSSGA VLSMQEDRSD KILSLPGRDD  300
KTSIAYGQVS HTIDPNGTPE LSPVTANDDS IEGAEDDDDP FSKRRKMDTG GFEVTPVVKP  360
IREPRVVVQT LSEVDILDDG YRWRKYGQKV VRGNPNPRSY YKCTNAGCPV RKHVERASHD  420
PKAVITTYEG KHNHDVPMAR TSSHDTTGPT AVNGASRIRS EESETISLDL GVGISSTTDN  480
RSNDQQQALH SELSQSQNQA SGSSFRIVPR ATIAPYYGVL NGGMNQYGSR QNPNEGRSVE  540
IPPLSHSSYP YPQNVGRLLT GP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-37203437477Probable WRKY transcription factor 4
2lex_A7e-37203437477Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002529048.10.0PREDICTED: probable WRKY transcription factor 20 isoform X2
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLB9SSS90.0B9SSS9_RICCO; WRKY transcription factor, putative
STRINGPOPTR_0001s37260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39463463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein